PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Mapoly0156s0012.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Marchantiophyta; Marchantiopsida; Marchantiidae; Marchantiales; Marchantiaceae; Marchantia
Family HD-ZIP
Protein Properties Length: 799aa    MW: 87213.1 Da    PI: 6.4659
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Mapoly0156s0012.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.11.1e-21114169156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t+ q++e+e +F+++++p+ ++r+eL+k+lgL+ rqVk+WFqNrR+++k
  Mapoly0156s0012.1.p 114 KKRYHRHTPRQIQEMEMVFKECPHPDDKQRQELSKELGLEPRQVKFWFQNRRTQMK 169
                          688999***********************************************998 PP

2START204.44.6e-643075311206
                          HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.... CS
                START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.... 77 
                          ela +a++elv++a+++ep+W        e +n+de++++f+++ +      ++ea r++g+v m+ ++lve+l+d   +W+e+++    
  Mapoly0156s0012.1.p 307 ELAVAAMDELVRLAQSDEPLWIPGHdgakETLNYDEYVRQFPRGIGpkpfgLKTEATRETGLVMMNGVTLVETLMDHV-RWTEMFPcmvs 395
                          57899*****************9999999**************999********************************.*********** PP

                          EEEEEEEECTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECT CS
                START  78 kaetlevissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksn 159
                          +a t+ev+s+g       galqlm+aelq+lsplvp R+ +f+R+++q+g+g w++vdvSvds +++p  + ++R++++pSg+li++++n
  Mapoly0156s0012.1.p 396 RALTVEVLSTGigacnrnGALQLMYAELQVLSPLVPtRECYFLRFCKQHGEGIWAVVDVSVDSLRDNP-PPALMRSRRRPSGCLIQDMPN 484
                          ********************************************************************.7******************** PP

                          CEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 160 ghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          g+skvt++eh+d+++r++  +++slv+sg+a+ga++w+atlqrqce+
  Mapoly0156s0012.1.p 485 GYSKVTVLEHMDYDDRTVNRMYKSLVNSGQAFGAQRWLATLQRQCER 531
                          *********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.1E-2197172IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-22101173IPR009057Homeodomain-like
PROSITE profilePS5007117.427111171IPR001356Homeobox domain
SMARTSM003892.1E-21112175IPR001356Homeobox domain
CDDcd000867.26E-21113172No hitNo description
PfamPF000463.5E-19114169IPR001356Homeobox domain
PRINTSPR000318.9E-5142151IPR000047Helix-turn-helix motif
PROSITE patternPS000270146169IPR017970Homeobox, conserved site
PRINTSPR000318.9E-5151167IPR000047Helix-turn-helix motif
PROSITE profilePS5084846.24298534IPR002913START domain
SuperFamilySSF559613.14E-39299533No hitNo description
CDDcd088751.36E-128302530No hitNo description
SMARTSM002343.3E-55307531IPR002913START domain
PfamPF018522.1E-54308531IPR002913START domain
Gene3DG3DSA:3.30.530.209.1E-7413513IPR023393START-like domain
SuperFamilySSF559611.88E-24559790No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048825Biological Processcotyledon development
GO:0090627Biological Processplant epidermal cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 799 aa     Download sequence    Send to blast
MRLGGVTVTV TANGGGVGPK YLSELAVMPS SVMAPPRLAP PNAMARGPQK NVFTSPGLSL  60
APPSGLEGQP QVSQSAESEQ VKQKDNEEYE SRSGSDNMEG GSGDDQDPDH PPRKKRYHRH  120
TPRQIQEMEM VFKECPHPDD KQRQELSKEL GLEPRQVKFW FQNRRTQMKA QQERAENSML  180
RAENEKLRSE NITMRDAMKN ASCPHCGGPT TMGEMSFDEQ QLRIENARLK DEIDRVSALA  240
AKYLGRPVAP MNSLPPMSTS SLELQVGGSF GMHQGTGTDL VPQGPSVADV ATRPGGLSDA  300
EKPMVFELAV AAMDELVRLA QSDEPLWIPG HDGAKETLNY DEYVRQFPRG IGPKPFGLKT  360
EATRETGLVM MNGVTLVETL MDHVRWTEMF PCMVSRALTV EVLSTGIGAC NRNGALQLMY  420
AELQVLSPLV PTRECYFLRF CKQHGEGIWA VVDVSVDSLR DNPPPALMRS RRRPSGCLIQ  480
DMPNGYSKVT VLEHMDYDDR TVNRMYKSLV NSGQAFGAQR WLATLQRQCE RLASMLASNL  540
SQRDLGGVPT ANGRRSMLKL AQRMTNNFCA GVSASTVHTW TTLAGSGEDD VRVMTRKSVD  600
NPGEPHGIVL SAATSLWLPV SPQRVFEFLR DERLRHEWDI LSNGGHVAEM AHIAKGQDPG  660
NSVSLLRVNA INPGQSNMLI LQESCTDVSG SLVIYAPVDI PAMTLVLQGG DPAYVALLPS  720
GFAILPDGPE NRRSLGDGSG LPESPRRTGG ALLTVAFQIL VSSVPSAKLS LESVATVNNL  780
ISCTVQRIKQ ALQVPDES*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002988402.10.0hypothetical protein SELMODRAFT_450553
SwissprotQ8RWU40.0ATML1_ARATH; Homeobox-leucine zipper protein MERISTEM L1
TrEMBLQ147S40.0Q147S4_PHYPA; Class IV HD-Zip protein HDZ43
STRINGPP1S209_10V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein